Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441
  1. Avatar for georg137 71. georg137 Lv 1 9 pts. 8,711
  2. Avatar for MicElephant 72. MicElephant Lv 1 9 pts. 8,690
  3. Avatar for manu8170 73. manu8170 Lv 1 9 pts. 8,690
  4. Avatar for alcor29 74. alcor29 Lv 1 8 pts. 8,687
  5. Avatar for Pibeagles 75. Pibeagles Lv 1 8 pts. 8,682
  6. Avatar for tarimo 76. tarimo Lv 1 8 pts. 8,675
  7. Avatar for YGK 77. YGK Lv 1 7 pts. 8,671
  8. Avatar for andrewtmaxwell 78. andrewtmaxwell Lv 1 7 pts. 8,661
  9. Avatar for pfirth 79. pfirth Lv 1 7 pts. 8,659
  10. Avatar for stomjoh 80. stomjoh Lv 1 6 pts. 8,659

Comments