Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843
  1. Avatar for harvardman 101. harvardman Lv 1 2 pts. 8,498
  2. Avatar for talbers 102. talbers Lv 1 2 pts. 8,495
  3. Avatar for Fog Darts 103. Fog Darts Lv 1 2 pts. 8,492
  4. Avatar for karost 104. karost Lv 1 2 pts. 8,483
  5. Avatar for guineapig 105. guineapig Lv 1 2 pts. 8,480
  6. Avatar for gu14001 106. gu14001 Lv 1 2 pts. 8,479
  7. Avatar for Jim Fraser 107. Jim Fraser Lv 1 2 pts. 8,478
  8. Avatar for teraflop 108. teraflop Lv 1 2 pts. 8,474
  9. Avatar for Merf 109. Merf Lv 1 2 pts. 8,463
  10. Avatar for philcalhoun 110. philcalhoun Lv 1 2 pts. 8,437

Comments