Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843
  1. Avatar for Iron pet 111. Iron pet Lv 1 1 pt. 8,419
  2. Avatar for mitarcher 112. mitarcher Lv 1 1 pt. 8,400
  3. Avatar for Nick_Flamel 113. Nick_Flamel Lv 1 1 pt. 8,397
  4. Avatar for dizzywings 114. dizzywings Lv 1 1 pt. 8,392
  5. Avatar for Cerzax 115. Cerzax Lv 1 1 pt. 8,390
  6. Avatar for 55SciOne 116. 55SciOne Lv 1 1 pt. 8,386
  7. Avatar for pooja chennupati 117. pooja chennupati Lv 1 1 pt. 8,367
  8. Avatar for SouperGenious 118. SouperGenious Lv 1 1 pt. 8,358
  9. Avatar for machinelves 119. machinelves Lv 1 1 pt. 8,352
  10. Avatar for MadCat08 120. MadCat08 Lv 1 1 pt. 8,346

Comments