Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843
  1. Avatar for randomlil 31. randomlil Lv 1 41 pts. 8,992
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 40 pts. 8,991
  3. Avatar for MurloW 33. MurloW Lv 1 39 pts. 8,981
  4. Avatar for diamonddays 34. diamonddays Lv 1 37 pts. 8,980
  5. Avatar for Blipperman 35. Blipperman Lv 1 36 pts. 8,969
  6. Avatar for Vinara 36. Vinara Lv 1 35 pts. 8,963
  7. Avatar for phi16 37. phi16 Lv 1 34 pts. 8,954
  8. Avatar for nicobul 38. nicobul Lv 1 33 pts. 8,950
  9. Avatar for NinjaGreg 39. NinjaGreg Lv 1 32 pts. 8,943
  10. Avatar for YeshuaLives 40. YeshuaLives Lv 1 30 pts. 8,939

Comments