Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843
  1. Avatar for tony46 51. tony46 Lv 1 21 pts. 8,891
  2. Avatar for fryguy 52. fryguy Lv 1 20 pts. 8,868
  3. Avatar for dcrwheeler 53. dcrwheeler Lv 1 19 pts. 8,865
  4. Avatar for smilingone 54. smilingone Lv 1 18 pts. 8,864
  5. Avatar for fishercat 55. fishercat Lv 1 18 pts. 8,855
  6. Avatar for Glen B 56. Glen B Lv 1 17 pts. 8,852
  7. Avatar for jobo0502 57. jobo0502 Lv 1 16 pts. 8,851
  8. Avatar for alwen 58. alwen Lv 1 16 pts. 8,849
  9. Avatar for uihcv 59. uihcv Lv 1 15 pts. 8,849
  10. Avatar for heather-1 60. heather-1 Lv 1 15 pts. 8,845

Comments