Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 6 pts. 9,020
  2. Avatar for Cannabis Crew 12. Cannabis Crew 4 pts. 8,854
  3. Avatar for xkcd 13. xkcd 3 pts. 8,749
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,713
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,490
  6. Avatar for Kotocycle 16. Kotocycle 1 pt. 8,461
  7. Avatar for :) 17. :) 1 pt. 8,411
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 8,243
  9. Avatar for freefolder 19. freefolder 1 pt. 8,167
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,977

  1. Avatar for pauldunn 11. pauldunn Lv 1 78 pts. 9,472
  2. Avatar for tokens 12. tokens Lv 1 76 pts. 9,467
  3. Avatar for Galaxie 13. Galaxie Lv 1 74 pts. 9,465
  4. Avatar for eusair 14. eusair Lv 1 72 pts. 9,464
  5. Avatar for O Seki To 15. O Seki To Lv 1 70 pts. 9,464
  6. Avatar for Blipperman 16. Blipperman Lv 1 68 pts. 9,457
  7. Avatar for mat747 17. mat747 Lv 1 66 pts. 9,455
  8. Avatar for caglar 18. caglar Lv 1 64 pts. 9,451
  9. Avatar for gitwut 19. gitwut Lv 1 62 pts. 9,448
  10. Avatar for actiasluna 20. actiasluna Lv 1 61 pts. 9,441

Comments