Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,605
  2. Avatar for Go Science 2. Go Science 81 pts. 9,563
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,521
  4. Avatar for HMT heritage 4. HMT heritage 50 pts. 9,518
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,474
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 9,473
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,455
  8. Avatar for Contenders 8. Contenders 17 pts. 9,448
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 9,125
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 9,102
  1. Avatar for pauldunn 11. pauldunn Lv 1 78 pts. 9,472
  2. Avatar for tokens 12. tokens Lv 1 76 pts. 9,467
  3. Avatar for Galaxie 13. Galaxie Lv 1 74 pts. 9,465
  4. Avatar for eusair 14. eusair Lv 1 72 pts. 9,464
  5. Avatar for O Seki To 15. O Seki To Lv 1 70 pts. 9,464
  6. Avatar for Blipperman 16. Blipperman Lv 1 68 pts. 9,457
  7. Avatar for mat747 17. mat747 Lv 1 66 pts. 9,455
  8. Avatar for caglar 18. caglar Lv 1 64 pts. 9,451
  9. Avatar for gitwut 19. gitwut Lv 1 62 pts. 9,448
  10. Avatar for actiasluna 20. actiasluna Lv 1 61 pts. 9,441

Comments