Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 7,545
  3. Avatar for Deleted group 23. Deleted group pts. 7,519
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466
  1. Avatar for gaving1 181. gaving1 Lv 1 1 pt. 7,225
  2. Avatar for BOB450 182. BOB450 Lv 1 1 pt. 7,201
  3. Avatar for BIO257C-pgguzman 183. BIO257C-pgguzman Lv 1 1 pt. 7,165
  4. Avatar for giffgiff1 184. giffgiff1 Lv 1 1 pt. 7,148
  5. Avatar for Gzxlm1234 185. Gzxlm1234 Lv 1 1 pt. 7,143
  6. Avatar for 01010011111 186. 01010011111 Lv 1 1 pt. 7,129
  7. Avatar for EnochRoot7 187. EnochRoot7 Lv 1 1 pt. 7,120
  8. Avatar for BIO257C-jabarca 188. BIO257C-jabarca Lv 1 1 pt. 7,003
  9. Avatar for simisola1 189. simisola1 Lv 1 1 pt. 6,871
  10. Avatar for TwistedM 190. TwistedM Lv 1 1 pt. 6,767

Comments