Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Deleted group 23. Deleted group pts. 7,519
  3. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466

  1. Avatar for kabubi 31. kabubi Lv 1 44 pts. 9,388
  2. Avatar for mimi 32. mimi Lv 1 43 pts. 9,369
  3. Avatar for Bletchley Park 33. Bletchley Park Lv 1 42 pts. 9,368
  4. Avatar for diamonddays 34. diamonddays Lv 1 40 pts. 9,367
  5. Avatar for shettler 35. shettler Lv 1 39 pts. 9,367
  6. Avatar for altejoh 36. altejoh Lv 1 38 pts. 9,362
  7. Avatar for hpaege 37. hpaege Lv 1 37 pts. 9,359
  8. Avatar for jobo0502 38. jobo0502 Lv 1 36 pts. 9,350
  9. Avatar for Aubade01 39. Aubade01 Lv 1 35 pts. 9,335
  10. Avatar for randomlil 40. randomlil Lv 1 34 pts. 9,334

Comments