1354: Revisiting Puzzle 91: Virus Protein

Closed since almost 9 years ago

Summary

• Created: March 15, 2017
• Expires: March 23, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

• 1. Anthropic Dreams 100 pts. 9,605
• 2. Go Science 81 pts. 9,563
• 3. Beta Folders 64 pts. 9,521
• 4. HMT heritage 50 pts. 9,518
• 5. Gargleblasters 39 pts. 9,474
• 6. L'Alliance Francophone 30 pts. 9,473
• 7. Void Crushers 23 pts. 9,455
• 8. Contenders 17 pts. 9,448
• 9. D001x Med Chem MOOC 12 pts. 9,125
• 10. Italiani Al Lavoro 9 pts. 9,102

Top soloists

• 31. kabubi 44 pts. 9,388
• 32. mimi 43 pts. 9,369
• 33. Bletchley Park 42 pts. 9,368
• 34. diamonddays 40 pts. 9,367
• 35. shettler 39 pts. 9,367
• 36. altejoh 38 pts. 9,362
• 37. hpaege 37 pts. 9,359
• 38. jobo0502 36 pts. 9,350
• 39. Aubade01 35 pts. 9,335
• 40. randomlil 34 pts. 9,334