Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for Deleted player 101. Deleted player pts. 8,450
  2. Avatar for uihcv 102. uihcv Lv 1 2 pts. 8,411
  3. Avatar for jtrube1 103. jtrube1 Lv 1 2 pts. 8,365
  4. Avatar for Deleted player 104. Deleted player pts. 8,363
  5. Avatar for glaciall 105. glaciall Lv 1 2 pts. 8,361
  6. Avatar for MadCat08 106. MadCat08 Lv 1 2 pts. 8,336
  7. Avatar for benrh 107. benrh Lv 1 2 pts. 8,290
  8. Avatar for gu14012 108. gu14012 Lv 1 2 pts. 8,282
  9. Avatar for navn 109. navn Lv 1 2 pts. 8,258
  10. Avatar for rezaefar 110. rezaefar Lv 1 2 pts. 8,257

Comments