Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,543
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,541
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,524
  4. Avatar for Contenders 4. Contenders 43 pts. 9,462
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 9,438
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,391
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,152
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,075
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,057
  1. Avatar for Deleted player 101. Deleted player pts. 8,450
  2. Avatar for uihcv 102. uihcv Lv 1 2 pts. 8,411
  3. Avatar for jtrube1 103. jtrube1 Lv 1 2 pts. 8,365
  4. Avatar for Deleted player 104. Deleted player pts. 8,363
  5. Avatar for glaciall 105. glaciall Lv 1 2 pts. 8,361
  6. Avatar for MadCat08 106. MadCat08 Lv 1 2 pts. 8,336
  7. Avatar for benrh 107. benrh Lv 1 2 pts. 8,290
  8. Avatar for gu14012 108. gu14012 Lv 1 2 pts. 8,282
  9. Avatar for navn 109. navn Lv 1 2 pts. 8,258
  10. Avatar for rezaefar 110. rezaefar Lv 1 2 pts. 8,257

Comments