Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for CH20XX 151. CH20XX Lv 1 1 pt. 7,702
  2. Avatar for Spikinours 152. Spikinours Lv 1 1 pt. 7,692
  3. Avatar for 01010011111 153. 01010011111 Lv 1 1 pt. 7,633
  4. Avatar for Superphosphate 154. Superphosphate Lv 1 1 pt. 7,630
  5. Avatar for yashoda 155. yashoda Lv 1 1 pt. 7,614
  6. Avatar for leehaggis 156. leehaggis Lv 1 1 pt. 7,481
  7. Avatar for frostschutz 157. frostschutz Lv 1 1 pt. 7,476
  8. Avatar for techbites457 158. techbites457 Lv 1 1 pt. 7,450
  9. Avatar for jebbiek 159. jebbiek Lv 1 1 pt. 7,449
  10. Avatar for Paulo Roque 160. Paulo Roque Lv 1 1 pt. 7,448

Comments