Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  6. Avatar for freefolder 17. freefolder 1 pt. 8,222
  7. Avatar for :) 18. :) 1 pt. 8,175
  8. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972

  1. Avatar for Tehnologik1 31. Tehnologik1 Lv 1 41 pts. 9,352
  2. Avatar for johnmitch 32. johnmitch Lv 1 40 pts. 9,339
  3. Avatar for tokens 33. tokens Lv 1 39 pts. 9,336
  4. Avatar for pvc78 34. pvc78 Lv 1 37 pts. 9,333
  5. Avatar for mimi 35. mimi Lv 1 36 pts. 9,330
  6. Avatar for jermainiac 36. jermainiac Lv 1 35 pts. 9,328
  7. Avatar for alwen 37. alwen Lv 1 34 pts. 9,323
  8. Avatar for kabubi 38. kabubi Lv 1 33 pts. 9,318
  9. Avatar for tony46 39. tony46 Lv 1 32 pts. 9,318
  10. Avatar for Norrjane 40. Norrjane Lv 1 31 pts. 9,300

Comments