Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,543
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,541
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,524
  4. Avatar for Contenders 4. Contenders 43 pts. 9,462
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 9,438
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,391
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,152
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,075
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,057
  1. Avatar for Tehnologik1 31. Tehnologik1 Lv 1 41 pts. 9,352
  2. Avatar for johnmitch 32. johnmitch Lv 1 40 pts. 9,339
  3. Avatar for tokens 33. tokens Lv 1 39 pts. 9,336
  4. Avatar for pvc78 34. pvc78 Lv 1 37 pts. 9,333
  5. Avatar for mimi 35. mimi Lv 1 36 pts. 9,330
  6. Avatar for jermainiac 36. jermainiac Lv 1 35 pts. 9,328
  7. Avatar for alwen 37. alwen Lv 1 34 pts. 9,323
  8. Avatar for kabubi 38. kabubi Lv 1 33 pts. 9,318
  9. Avatar for tony46 39. tony46 Lv 1 32 pts. 9,318
  10. Avatar for Norrjane 40. Norrjane Lv 1 31 pts. 9,300

Comments