Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for dssb 61. dssb Lv 1 14 pts. 9,138
  2. Avatar for jobo0502 62. jobo0502 Lv 1 14 pts. 9,113
  3. Avatar for manu8170 63. manu8170 Lv 1 13 pts. 9,111
  4. Avatar for MicElephant 64. MicElephant Lv 1 13 pts. 9,089
  5. Avatar for pmdpmd 65. pmdpmd Lv 1 12 pts. 9,089
  6. Avatar for Mr_Jolty 66. Mr_Jolty Lv 1 12 pts. 9,075
  7. Avatar for mitarcher 67. mitarcher Lv 1 11 pts. 9,067
  8. Avatar for andrewxc 68. andrewxc Lv 1 11 pts. 9,060
  9. Avatar for Bushman 69. Bushman Lv 1 10 pts. 9,057
  10. Avatar for weitzen 70. weitzen Lv 1 10 pts. 9,057

Comments