Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,543
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,541
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,524
  4. Avatar for Contenders 4. Contenders 43 pts. 9,462
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 9,438
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,391
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,152
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,075
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,057
  1. Avatar for dssb 61. dssb Lv 1 14 pts. 9,138
  2. Avatar for jobo0502 62. jobo0502 Lv 1 14 pts. 9,113
  3. Avatar for manu8170 63. manu8170 Lv 1 13 pts. 9,111
  4. Avatar for MicElephant 64. MicElephant Lv 1 13 pts. 9,089
  5. Avatar for pmdpmd 65. pmdpmd Lv 1 12 pts. 9,089
  6. Avatar for Mr_Jolty 66. Mr_Jolty Lv 1 12 pts. 9,075
  7. Avatar for mitarcher 67. mitarcher Lv 1 11 pts. 9,067
  8. Avatar for andrewxc 68. andrewxc Lv 1 11 pts. 9,060
  9. Avatar for Bushman 69. Bushman Lv 1 10 pts. 9,057
  10. Avatar for weitzen 70. weitzen Lv 1 10 pts. 9,057

Comments