Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  6. Avatar for freefolder 17. freefolder 1 pt. 8,222
  7. Avatar for :) 18. :) 1 pt. 8,175
  8. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972

  1. Avatar for dam_01 81. dam_01 Lv 1 6 pts. 8,862
  2. Avatar for fishercat 82. fishercat Lv 1 6 pts. 8,836
  3. Avatar for altejoh 83. altejoh Lv 1 6 pts. 8,796
  4. Avatar for froggs554 84. froggs554 Lv 1 5 pts. 8,789
  5. Avatar for fryguy 85. fryguy Lv 1 5 pts. 8,776
  6. Avatar for jamiexq 86. jamiexq Lv 1 5 pts. 8,760
  7. Avatar for demeter900 87. demeter900 Lv 1 5 pts. 8,756
  8. Avatar for SKSbell 88. SKSbell Lv 1 4 pts. 8,698
  9. Avatar for gu14003 89. gu14003 Lv 1 4 pts. 8,697
  10. Avatar for ralan-nsk 90. ralan-nsk Lv 1 4 pts. 8,678

Comments