Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,543
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,541
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,524
  4. Avatar for Contenders 4. Contenders 43 pts. 9,462
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 9,438
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,391
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,152
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,075
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,057
  1. Avatar for dam_01 81. dam_01 Lv 1 6 pts. 8,862
  2. Avatar for fishercat 82. fishercat Lv 1 6 pts. 8,836
  3. Avatar for altejoh 83. altejoh Lv 1 6 pts. 8,796
  4. Avatar for froggs554 84. froggs554 Lv 1 5 pts. 8,789
  5. Avatar for fryguy 85. fryguy Lv 1 5 pts. 8,776
  6. Avatar for jamiexq 86. jamiexq Lv 1 5 pts. 8,760
  7. Avatar for demeter900 87. demeter900 Lv 1 5 pts. 8,756
  8. Avatar for SKSbell 88. SKSbell Lv 1 4 pts. 8,698
  9. Avatar for gu14003 89. gu14003 Lv 1 4 pts. 8,697
  10. Avatar for ralan-nsk 90. ralan-nsk Lv 1 4 pts. 8,678

Comments