Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 8,367
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 7 pts. 8,345
  3. Avatar for HMT heritage 13. HMT heritage 5 pts. 8,259
  4. Avatar for xkcd 14. xkcd 4 pts. 7,852
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 3 pts. 7,833
  6. Avatar for :) 16. :) 2 pts. 7,730
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,558
  8. Avatar for foldeRNA 18. foldeRNA 1 pt. 7,327
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 6,987
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 6,503
  1. Avatar for yashoda 141. yashoda Lv 1 1 pt. 5,887
  2. Avatar for Pachypodium 142. Pachypodium Lv 1 1 pt. 5,804
  3. Avatar for mmitchell51 143. mmitchell51 Lv 1 1 pt. 5,769
  4. Avatar for talbers 144. talbers Lv 1 1 pt. 5,736
  5. Avatar for Deleted player 145. Deleted player pts. 5,621
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 5,488
  7. Avatar for halberstram 147. halberstram Lv 1 1 pt. 5,428
  8. Avatar for pooja chennupati 148. pooja chennupati Lv 1 1 pt. 5,421
  9. Avatar for doctaven 149. doctaven Lv 1 1 pt. 5,340
  10. Avatar for saksoft2 150. saksoft2 Lv 1 1 pt. 5,303

Comments