Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for BCH4103L 21. BCH4103L 1 pt. 5,769
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,340
  3. Avatar for LEC Metabolites 23. LEC Metabolites 1 pt. 4,891
  4. Avatar for BSM4601 24. BSM4601 1 pt. 3,837
  5. Avatar for SFASU_BIOL4356/5356 25. SFASU_BIOL4356/5356 1 pt. 3,781
  6. Avatar for Fold it NA3A Sundsgymnasiet 2021 26. Fold it NA3A Sundsgymnasiet 2021 1 pt. 3,217
  7. Avatar for Deleted group 27. Deleted group pts. 0
  1. Avatar for yashoda 141. yashoda Lv 1 1 pt. 5,887
  2. Avatar for Pachypodium 142. Pachypodium Lv 1 1 pt. 5,804
  3. Avatar for mmitchell51 143. mmitchell51 Lv 1 1 pt. 5,769
  4. Avatar for talbers 144. talbers Lv 1 1 pt. 5,736
  5. Avatar for Deleted player 145. Deleted player pts. 5,621
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 5,488
  7. Avatar for halberstram 147. halberstram Lv 1 1 pt. 5,428
  8. Avatar for pooja chennupati 148. pooja chennupati Lv 1 1 pt. 5,421
  9. Avatar for doctaven 149. doctaven Lv 1 1 pt. 5,340
  10. Avatar for saksoft2 150. saksoft2 Lv 1 1 pt. 5,303

Comments