Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 2 pts. 8,728
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  8. Avatar for :) 18. :) 1 pt. 8,492
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 8,310
  10. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194
  1. Avatar for lovro126 161. lovro126 Lv 1 1 pt. 7,620
  2. Avatar for glaciall 162. glaciall Lv 1 1 pt. 7,599
  3. Avatar for Sachain 163. Sachain Lv 1 1 pt. 7,342
  4. Avatar for lucyz 164. lucyz Lv 1 1 pt. 7,314
  5. Avatar for 01010011111 165. 01010011111 Lv 1 1 pt. 7,157
  6. Avatar for beoswind 166. beoswind Lv 1 1 pt. 6,955
  7. Avatar for avaldivi 167. avaldivi Lv 1 1 pt. 6,881
  8. Avatar for jflat06 168. jflat06 Lv 1 1 pt. 3,880
  9. Avatar for alcor29 169. alcor29 Lv 1 1 pt. 3,880
  10. Avatar for hpaege 170. hpaege Lv 1 1 pt. 3,880

Comments