Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,531
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,466
  3. Avatar for Go Science 3. Go Science 65 pts. 9,423
  4. Avatar for Gargleblasters 4. Gargleblasters 52 pts. 9,400
  5. Avatar for Contenders 5. Contenders 41 pts. 9,368
  6. Avatar for HMT heritage 6. HMT heritage 32 pts. 9,367
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,353
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,302
  9. Avatar for Russian team 9. Russian team 14 pts. 9,291
  10. Avatar for D001x Med Chem MOOC 10. D001x Med Chem MOOC 10 pts. 9,273
  1. Avatar for lovro126 161. lovro126 Lv 1 1 pt. 7,620
  2. Avatar for glaciall 162. glaciall Lv 1 1 pt. 7,599
  3. Avatar for Sachain 163. Sachain Lv 1 1 pt. 7,342
  4. Avatar for lucyz 164. lucyz Lv 1 1 pt. 7,314
  5. Avatar for 01010011111 165. 01010011111 Lv 1 1 pt. 7,157
  6. Avatar for beoswind 166. beoswind Lv 1 1 pt. 6,955
  7. Avatar for avaldivi 167. avaldivi Lv 1 1 pt. 6,881
  8. Avatar for jflat06 168. jflat06 Lv 1 1 pt. 3,880
  9. Avatar for alcor29 169. alcor29 Lv 1 1 pt. 3,880
  10. Avatar for hpaege 170. hpaege Lv 1 1 pt. 3,880

Comments