Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for Cerzax 141. Cerzax Lv 1 1 pt. 8,004
  2. Avatar for JessicaDelgado21 142. JessicaDelgado21 Lv 1 1 pt. 7,988
  3. Avatar for petroskyma 143. petroskyma Lv 1 1 pt. 7,977
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 7,952
  5. Avatar for sammiibee16 145. sammiibee16 Lv 1 1 pt. 7,950
  6. Avatar for bergie72 146. bergie72 Lv 1 1 pt. 7,933
  7. Avatar for emdee314 147. emdee314 Lv 1 1 pt. 7,931
  8. Avatar for tela 148. tela Lv 1 1 pt. 7,919
  9. Avatar for momadoc 149. momadoc Lv 1 1 pt. 7,903
  10. Avatar for MatthewM7 150. MatthewM7 Lv 1 1 pt. 7,840

Comments