Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,531
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,466
  3. Avatar for Go Science 3. Go Science 65 pts. 9,423
  4. Avatar for Gargleblasters 4. Gargleblasters 52 pts. 9,400
  5. Avatar for Contenders 5. Contenders 41 pts. 9,368
  6. Avatar for HMT heritage 6. HMT heritage 32 pts. 9,367
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,353
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,302
  9. Avatar for Russian team 9. Russian team 14 pts. 9,291
  10. Avatar for D001x Med Chem MOOC 10. D001x Med Chem MOOC 10 pts. 9,273
  1. Avatar for Cerzax 141. Cerzax Lv 1 1 pt. 8,004
  2. Avatar for JessicaDelgado21 142. JessicaDelgado21 Lv 1 1 pt. 7,988
  3. Avatar for petroskyma 143. petroskyma Lv 1 1 pt. 7,977
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 7,952
  5. Avatar for sammiibee16 145. sammiibee16 Lv 1 1 pt. 7,950
  6. Avatar for bergie72 146. bergie72 Lv 1 1 pt. 7,933
  7. Avatar for emdee314 147. emdee314 Lv 1 1 pt. 7,931
  8. Avatar for tela 148. tela Lv 1 1 pt. 7,919
  9. Avatar for momadoc 149. momadoc Lv 1 1 pt. 7,903
  10. Avatar for MatthewM7 150. MatthewM7 Lv 1 1 pt. 7,840

Comments