Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for lovro126 161. lovro126 Lv 1 1 pt. 7,620
  2. Avatar for glaciall 162. glaciall Lv 1 1 pt. 7,599
  3. Avatar for Sachain 163. Sachain Lv 1 1 pt. 7,342
  4. Avatar for lucyz 164. lucyz Lv 1 1 pt. 7,314
  5. Avatar for 01010011111 165. 01010011111 Lv 1 1 pt. 7,157
  6. Avatar for beoswind 166. beoswind Lv 1 1 pt. 6,955
  7. Avatar for avaldivi 167. avaldivi Lv 1 1 pt. 6,881
  8. Avatar for rezaefar 168. rezaefar Lv 1 1 pt. 3,880
  9. Avatar for Lord_FoxxDrake 169. Lord_FoxxDrake Lv 1 1 pt. 3,880
  10. Avatar for jflat06 170. jflat06 Lv 1 1 pt. 3,880

Comments