Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 55 pts. 9,303
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 53 pts. 9,302
  3. Avatar for nicobul 23. nicobul Lv 1 52 pts. 9,302
  4. Avatar for frood66 24. frood66 Lv 1 50 pts. 9,290
  5. Avatar for kabubi 25. kabubi Lv 1 49 pts. 9,282
  6. Avatar for D001x_ErlandStevens 26. D001x_ErlandStevens Lv 1 47 pts. 9,273
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 45 pts. 9,271
  8. Avatar for pvc78 28. pvc78 Lv 1 44 pts. 9,266
  9. Avatar for johnmitch 29. johnmitch Lv 1 43 pts. 9,264
  10. Avatar for Aubade01 30. Aubade01 Lv 1 41 pts. 9,263

Comments