1363: Unsolved De-novo Freestyle: Predicted Contacts
Closed since about 9 years ago
Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted ContactsSummary
- Created
- April 07, 2017
- Expires
- Max points
- 100
This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.
Sequence:
PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE