Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 14,287
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 13,910
  3. Avatar for Go Science 3. Go Science 58 pts. 13,351
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 13,243
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 13,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 12,757
  7. Avatar for Deleted group 7. Deleted group pts. 12,640
  8. Avatar for Contenders 8. Contenders 11 pts. 12,206
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 11,603
  10. Avatar for xkcd 10. xkcd 5 pts. 11,521
  1. Avatar for Mr_Jolty 91. Mr_Jolty Lv 1 3 pts. 10,420
  2. Avatar for Mydogisa Toelicker 92. Mydogisa Toelicker Lv 1 2 pts. 10,404
  3. Avatar for benrh 93. benrh Lv 1 2 pts. 10,263
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 2 pts. 10,244
  5. Avatar for MadCat08 95. MadCat08 Lv 1 2 pts. 10,230
  6. Avatar for deLaCeiba 96. deLaCeiba Lv 1 2 pts. 10,204
  7. Avatar for trentis1 97. trentis1 Lv 1 2 pts. 10,164
  8. Avatar for boondog 98. boondog Lv 1 2 pts. 10,146
  9. Avatar for Iron pet 99. Iron pet Lv 1 2 pts. 10,064
  10. Avatar for JUMELLE54 100. JUMELLE54 Lv 1 2 pts. 9,991

Comments