Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for D001x Med Chem MOOC 11. D001x Med Chem MOOC 3 pts. 11,436
  2. Avatar for Russian team 12. Russian team 2 pts. 11,388
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 11,237
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,960
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 10,805
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 10,420
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,896
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 7,906
  9. Avatar for Mojo Risin' 19. Mojo Risin' 1 pt. 7,832
  10. Avatar for BioChem22017 20. BioChem22017 1 pt. 211
  1. Avatar for reefyrob 11. reefyrob Lv 1 74 pts. 13,142
  2. Avatar for Timo van der Laan 12. Timo van der Laan Lv 1 71 pts. 13,026
  3. Avatar for LociOiling 13. LociOiling Lv 1 69 pts. 12,973
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 67 pts. 12,926
  5. Avatar for Vredeman 15. Vredeman Lv 1 65 pts. 12,826
  6. Avatar for Keresto 16. Keresto Lv 1 63 pts. 12,778
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 61 pts. 12,757
  8. Avatar for jermainiac 18. jermainiac Lv 1 59 pts. 12,668
  9. Avatar for pauldunn 19. pauldunn Lv 1 57 pts. 12,661
  10. Avatar for ZeroLeak7 20. ZeroLeak7 Lv 1 55 pts. 12,644

Comments