1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since almost 9 years ago

Summary

• Created: April 07, 2017
• Expires: April 14, 2017 at 23:00 UTC
• Max points: 100

Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:

PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

• 1. Anthropic Dreams 100 pts. 14,287
• 2. Beta Folders 77 pts. 13,910
• 3. Go Science 58 pts. 13,351
• 4. Gargleblasters 43 pts. 13,243
• 5. Void Crushers 31 pts. 13,026
• 6. L'Alliance Francophone 22 pts. 12,757
• 7. Deleted group pts. 12,640
• 8. Contenders 11 pts. 12,206
• 9. HMT heritage 7 pts. 11,603
• 10. xkcd 5 pts. 11,521

Top soloists

• 81. philcalhoun 4 pts. 10,878
• 82. Glen B 4 pts. 10,873
• 83. harvardman 4 pts. 10,839
• 84. gu14014 4 pts. 10,805
• 85. stomjoh 3 pts. 10,765
• 86. WBarme1234 3 pts. 10,694
• 87. joaniegirl 3 pts. 10,500
• 88. pvc78 3 pts. 10,461
• 89. Pibeagles 3 pts. 10,453
• 90. RestrictionEndoNykolease 3 pts. 10,450