Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,173
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for xkcd 13. xkcd 1 pt. 8,992
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,888
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,760
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,500
  7. Avatar for SHELL 17. SHELL 1 pt. 5,410
  8. Avatar for Window Group 18. Window Group 1 pt. 3,369
  1. Avatar for Pibeagles 171. Pibeagles Lv 1 1 pt. 7,767
  2. Avatar for Soggy Doglog 172. Soggy Doglog Lv 1 1 pt. 7,321
  3. Avatar for 41622221LUOZHI 173. 41622221LUOZHI Lv 1 1 pt. 5,410
  4. Avatar for alcor29 174. alcor29 Lv 1 1 pt. 3,369
  5. Avatar for Paulo Roque 175. Paulo Roque Lv 1 1 pt. 3,369
  6. Avatar for jflat06 176. jflat06 Lv 1 1 pt. 3,369
  7. Avatar for guygeva2311 177. guygeva2311 Lv 1 1 pt. 3,369
  8. Avatar for annawrig 178. annawrig Lv 1 1 pt. 3,369
  9. Avatar for Hollinas 179. Hollinas Lv 1 1 pt. 3,369
  10. Avatar for yhbui 180. yhbui Lv 1 1 pt. 3,369

Comments