Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,173
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for xkcd 13. xkcd 1 pt. 8,992
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,888
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,760
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,500
  7. Avatar for SHELL 17. SHELL 1 pt. 5,410
  8. Avatar for Window Group 18. Window Group 1 pt. 3,369
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 41 pts. 9,321
  2. Avatar for Museka 32. Museka Lv 1 39 pts. 9,319
  3. Avatar for alwen 33. alwen Lv 1 38 pts. 9,317
  4. Avatar for Scopper 34. Scopper Lv 1 37 pts. 9,314
  5. Avatar for D001x_ErlandStevens 35. D001x_ErlandStevens Lv 1 36 pts. 9,314
  6. Avatar for caglar 36. caglar Lv 1 34 pts. 9,312
  7. Avatar for O Seki To 37. O Seki To Lv 1 33 pts. 9,306
  8. Avatar for altejoh 38. altejoh Lv 1 32 pts. 9,298
  9. Avatar for joremen 39. joremen Lv 1 31 pts. 9,296
  10. Avatar for diamonddays 40. diamonddays Lv 1 30 pts. 9,289

Comments