1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Summary

• Created: April 13, 2017
• Expires: April 20, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca²⁺ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca²⁺ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

• 1. Contenders 100 pts. 9,489
• 2. Beta Folders 74 pts. 9,476
• 3. Anthropic Dreams 54 pts. 9,458
• 4. Go Science 38 pts. 9,425
• 5. Void Crushers 27 pts. 9,415
• 6. L'Alliance Francophone 18 pts. 9,414
• 7. Gargleblasters 12 pts. 9,408
• 8. D001x Med Chem MOOC 8 pts. 9,314
• 9. HMT heritage 5 pts. 9,306
• 10. Italiani Al Lavoro 3 pts. 9,244

Top soloists

• 31. dcrwheeler 41 pts. 9,321
• 32. Museka 39 pts. 9,319
• 33. alwen 38 pts. 9,317
• 34. Scopper 37 pts. 9,314
• 35. D001x_ErlandStevens 36 pts. 9,314
• 36. caglar 34 pts. 9,312
• 37. O Seki To 33 pts. 9,306
• 38. altejoh 32 pts. 9,298
• 39. joremen 31 pts. 9,296
• 40. diamonddays 30 pts. 9,289