1365: Revisiting Puzzle 95: Chicken
Closed since almost 9 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- April 13, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE