Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Contenders 100 pts. 9,489
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,476
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,458
  4. Avatar for Go Science 4. Go Science 38 pts. 9,425
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,415
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,414
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,408
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 8 pts. 9,314
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,306
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,244

  1. Avatar for phi16 81. phi16 Lv 1 6 pts. 9,099
  2. Avatar for Deleted player 82. Deleted player pts. 9,093
  3. Avatar for froggs554 83. froggs554 Lv 1 5 pts. 9,088
  4. Avatar for Superphosphate 84. Superphosphate Lv 1 5 pts. 9,080
  5. Avatar for dssb 85. dssb Lv 1 5 pts. 9,060
  6. Avatar for philcalhoun 86. philcalhoun Lv 1 5 pts. 9,059
  7. Avatar for mitarcher 87. mitarcher Lv 1 4 pts. 9,057
  8. Avatar for ViJay7019 88. ViJay7019 Lv 1 4 pts. 9,056
  9. Avatar for spvincent 89. spvincent Lv 1 4 pts. 9,055
  10. Avatar for smholst 90. smholst Lv 1 4 pts. 9,045

Comments