Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Contenders 100 pts. 9,489
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,476
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,458
  4. Avatar for Go Science 4. Go Science 38 pts. 9,425
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,415
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,414
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,408
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 8 pts. 9,314
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,306
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,244

  1. Avatar for cbwest 71. cbwest Lv 1 9 pts. 9,146
  2. Avatar for pfirth 72. pfirth Lv 1 9 pts. 9,143
  3. Avatar for hansvandenhof 73. hansvandenhof Lv 1 8 pts. 9,142
  4. Avatar for kabubi 74. kabubi Lv 1 8 pts. 9,141
  5. Avatar for Deleted player 75. Deleted player 8 pts. 9,138
  6. Avatar for fishercat 76. fishercat Lv 1 7 pts. 9,126
  7. Avatar for lupussapien 77. lupussapien Lv 1 7 pts. 9,112
  8. Avatar for johngran 78. johngran Lv 1 7 pts. 9,103
  9. Avatar for JUMELLE54 79. JUMELLE54 Lv 1 6 pts. 9,101
  10. Avatar for Bushman 80. Bushman Lv 1 6 pts. 9,099

Comments