1366: Electron Density Practice: Cell Surface Marker

Closed since almost 9 years ago

Summary

• Created: April 14, 2017
• Expires: April 21, 2017 at 23:00 UTC
• Max points: 100

Description

Note: This puzzle was posted with an incorrect sequence and closed early. It is superseded by Puzzle 1366b.



This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT

Top groups

• 1. Gargleblasters 100 pts. 9,113
• 2. L'Alliance Francophone 33 pts. 8,468
• 3. Beta Folders 8 pts. 7,471
• 4. Anthropic Dreams 2 pts. 7,166
• 5. Go Science 1 pt. 5,900
• 6. Italiani Al Lavoro 1 pt. 0

Top soloists

• 1. tomespen 100 pts. 9,113
• 2. nicobul 78 pts. 8,468
• 3. rabamino12358 60 pts. 8,408
• 4. jobo0502 45 pts. 8,137
• 5. johnmitch 33 pts. 7,899
• 6. katling 24 pts. 7,694
• 7. bcre8tvv 17 pts. 7,522
• 8. smilingone 12 pts. 7,471
• 9. alwen 8 pts. 7,166
• 10. dcrwheeler 6 pts. 6,658