Placeholder image of a protein
Icon representing a puzzle

1366: Electron Density Practice: Cell Surface Marker

Closed since almost 9 years ago

Intermediate

Summary


Created
April 14, 2017
Expires
Max points
100
Description

Note: This puzzle was posted with an incorrect sequence and closed early. It is superseded by Puzzle 1366b.



This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,113
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 33 pts. 8,468
  3. Avatar for Beta Folders 3. Beta Folders 8 pts. 7,471
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 2 pts. 7,166
  5. Avatar for Go Science 5. Go Science 1 pt. 5,900

No scores of this type to display!

Comments