1366: Electron Density Practice: Cell Surface Marker
Closed since almost 9 years ago
IntermediateSummary
- Created
- April 14, 2017
- Expires
- Max points
- 100
Note: This puzzle was posted with an incorrect sequence and closed early. It is superseded by Puzzle 1366b.
This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
GTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT
Top groups
-
100 pts. 9,113
-
-
-
-
-
No scores of this type to display!