1366b: Electron Density Practice: Cell Surface Marker
Closed since almost 9 years ago
Intermediate Overall Prediction Electron DensitySummary
- Created
- April 15, 2017
- Expires
- Max points
- 100
Note: This puzzle replaces Puzzle 1366, which was originally posted with an incorrect sequence.
This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Note that part of this protein is "disordered" in the original crystal structure; not all residues will fit into the density! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT