Placeholder image of a protein
Icon representing a puzzle

1366b: Electron Density Practice: Cell Surface Marker

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
April 15, 2017
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1366, which was originally posted with an incorrect sequence.



This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Note that part of this protein is "disordered" in the original crystal structure; not all residues will fit into the density! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 8,979
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,943
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,849
  4. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,039
  5. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,011
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,804
  7. Avatar for Deleted group 18. Deleted group pts. 0

  1. Avatar for Pibeagles 121. Pibeagles Lv 1 1 pt. 7,538
  2. Avatar for David M. 122. David M. Lv 1 1 pt. 7,370
  3. Avatar for scottwuzhear 123. scottwuzhear Lv 1 1 pt. 7,306
  4. Avatar for Deleted player 124. Deleted player pts. 7,192
  5. Avatar for cnhrcolemam 125. cnhrcolemam Lv 1 1 pt. 7,102
  6. Avatar for pandapharmd 126. pandapharmd Lv 1 1 pt. 6,879
  7. Avatar for tweak64 127. tweak64 Lv 1 1 pt. 6,580
  8. Avatar for jamiexq 128. jamiexq Lv 1 1 pt. 6,579
  9. Avatar for SaraL 129. SaraL Lv 1 1 pt. 6,292
  10. Avatar for chrisStockbridge 130. chrisStockbridge Lv 1 1 pt. 6,284

Comments