Placeholder image of a protein
Icon representing a puzzle

1366b: Electron Density Practice: Cell Surface Marker

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
April 15, 2017
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1366, which was originally posted with an incorrect sequence.



This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Note that part of this protein is "disordered" in the original crystal structure; not all residues will fit into the density! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 8,979
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,943
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,849
  4. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,039
  5. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,011
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,804
  7. Avatar for Deleted group 18. Deleted group pts. 0

  1. Avatar for momadoc 131. momadoc Lv 1 1 pt. 6,190
  2. Avatar for 01010011111 132. 01010011111 Lv 1 1 pt. 6,153
  3. Avatar for penteplayer 133. penteplayer Lv 1 1 pt. 6,044
  4. Avatar for Inkedhands 134. Inkedhands Lv 1 1 pt. 6,031
  5. Avatar for hansvandenhof 135. hansvandenhof Lv 1 1 pt. 5,784
  6. Avatar for Jaco van As 136. Jaco van As Lv 1 1 pt. 5,743
  7. Avatar for gmn 137. gmn Lv 1 1 pt. 5,513
  8. Avatar for rezaefar 138. rezaefar Lv 1 1 pt. 5,473
  9. Avatar for Sci1217 139. Sci1217 Lv 1 1 pt. 5,472
  10. Avatar for 41622250 140. 41622250 Lv 1 1 pt. 5,414

Comments