Placeholder image of a protein
Icon representing a puzzle

1366b: Electron Density Practice: Cell Surface Marker

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 15, 2017
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1366, which was originally posted with an incorrect sequence.



This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Note that part of this protein is "disordered" in the original crystal structure; not all residues will fit into the density! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 8,979
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,943
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,849
  4. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,039
  5. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,011
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,804
  7. Avatar for Deleted group 18. Deleted group pts. 0

  1. Avatar for spvincent 152. spvincent Lv 1 1 pt. 0
  2. Avatar for jeff101 154. jeff101 Lv 1 1 pt. 0
  3. Avatar for deLaCeiba 155. deLaCeiba Lv 1 1 pt. 0
  4. Avatar for Hollinas 156. Hollinas Lv 1 1 pt. 0
  5. Avatar for Zed3 157. Zed3 Lv 1 1 pt. 0
  6. Avatar for fishercat 159. fishercat Lv 1 1 pt. 0
  7. Avatar for roman madala 160. roman madala Lv 1 1 pt. 0

Comments