Placeholder image of a protein
Icon representing a puzzle

1366b: Electron Density Practice: Cell Surface Marker

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
April 15, 2017
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1366, which was originally posted with an incorrect sequence.



This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Note that part of this protein is "disordered" in the original crystal structure; not all residues will fit into the density! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT

Top groups


  1. Avatar for Beta Folders 100 pts. 14,003
  2. Avatar for Contenders 2. Contenders 74 pts. 13,992
  3. Avatar for Go Science 3. Go Science 54 pts. 13,968
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 13,952
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 13,882
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 13,334
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 10,795
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,757
  9. Avatar for Russian team 9. Russian team 5 pts. 9,213
  10. Avatar for Natural Abilities 10. Natural Abilities 3 pts. 9,180

  1. Avatar for Jim Fraser 61. Jim Fraser Lv 1 10 pts. 9,278
  2. Avatar for georg137 62. georg137 Lv 1 10 pts. 9,274
  3. Avatar for tony46 63. tony46 Lv 1 9 pts. 9,264
  4. Avatar for ralan-nsk 64. ralan-nsk Lv 1 9 pts. 9,213
  5. Avatar for Mr_Jolty 65. Mr_Jolty Lv 1 9 pts. 9,180
  6. Avatar for tomespen 66. tomespen Lv 1 8 pts. 9,126
  7. Avatar for smholst 67. smholst Lv 1 8 pts. 9,119
  8. Avatar for WalkerP 68. WalkerP Lv 1 7 pts. 9,085
  9. Avatar for Deleted player 69. Deleted player pts. 9,085
  10. Avatar for cbwest 70. cbwest Lv 1 7 pts. 9,018

Comments