Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for kabubi
    1. kabubi Lv 1
    100 pts. 9,547
  2. Avatar for smilingone 2. smilingone Lv 1 81 pts. 9,536
  3. Avatar for LociOiling 3. LociOiling Lv 1 65 pts. 9,534
  4. Avatar for Hollinas 4. Hollinas Lv 1 52 pts. 9,534
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 41 pts. 9,524
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 32 pts. 9,524
  7. Avatar for Paulo Roque 7. Paulo Roque Lv 1 24 pts. 9,521
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 18 pts. 9,520
  9. Avatar for eromana 9. eromana Lv 1 14 pts. 9,486
  10. Avatar for Deleted player 10. Deleted player pts. 9,486

Comments