1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Summary

• Created: April 20, 2017
• Expires: April 27, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

• 1. Void Crushers 100 pts. 9,557
• 2. Beta Folders 77 pts. 9,536
• 3. Go Science 58 pts. 9,534
• 4. Anthropic Dreams 43 pts. 9,490
• 5. Gargleblasters 31 pts. 9,486
• 6. Contenders 22 pts. 9,455
• 7. L'Alliance Francophone 15 pts. 9,440
• 8. HMT heritage 11 pts. 9,412
• 9. Natural Abilities 7 pts. 9,269
• 10. Italiani Al Lavoro 5 pts. 9,268

Top soloists

• 1. Timo van der Laan 100 pts. 9,557
• 2. LociOiling 98 pts. 9,534
• 3. fiendish_ghoul 95 pts. 9,523
• 4. markm457 92 pts. 9,490
• 5. retiredmichael 90 pts. 9,476
• 6. frood66 87 pts. 9,472
• 7. Galaxie 85 pts. 9,468
• 8. actiasluna 82 pts. 9,464
• 9. johnmitch 80 pts. 9,461
• 10. pauldunn 78 pts. 9,455