Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for Pibeagles 121. Pibeagles Lv 1 1 pt. 8,186
  2. Avatar for SouperGenious 122. SouperGenious Lv 1 1 pt. 8,183
  3. Avatar for pandapharmd 123. pandapharmd Lv 1 1 pt. 8,179
  4. Avatar for firejuggler 124. firejuggler Lv 1 1 pt. 8,175
  5. Avatar for Cerzax 125. Cerzax Lv 1 1 pt. 8,172
  6. Avatar for sammiibee16 126. sammiibee16 Lv 1 1 pt. 8,139
  7. Avatar for momadoc 127. momadoc Lv 1 1 pt. 8,130
  8. Avatar for rezaefar 128. rezaefar Lv 1 1 pt. 8,128
  9. Avatar for anthion 129. anthion Lv 1 1 pt. 8,122
  10. Avatar for Keresto 130. Keresto Lv 1 1 pt. 8,098

Comments