Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for Pagdzin 151. Pagdzin Lv 1 1 pt. 7,890
  2. Avatar for NotJim99 152. NotJim99 Lv 1 1 pt. 7,886
  3. Avatar for anandamide 153. anandamide Lv 1 1 pt. 7,872
  4. Avatar for emdee314 154. emdee314 Lv 1 1 pt. 7,868
  5. Avatar for 7-eon 155. 7-eon Lv 1 1 pt. 7,867
  6. Avatar for mirjamvandelft 156. mirjamvandelft Lv 1 1 pt. 7,855
  7. Avatar for chaosmasttter 157. chaosmasttter Lv 1 1 pt. 7,821
  8. Avatar for doctaven 158. doctaven Lv 1 1 pt. 7,808
  9. Avatar for Jiang Xiaohan 159. Jiang Xiaohan Lv 1 1 pt. 7,768
  10. Avatar for ComputerMage 160. ComputerMage Lv 1 1 pt. 7,757

Comments