Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 75 pts. 9,453
  2. Avatar for Scopper 12. Scopper Lv 1 73 pts. 9,451
  3. Avatar for eusair 13. eusair Lv 1 71 pts. 9,443
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 69 pts. 9,440
  5. Avatar for nicobul 15. nicobul Lv 1 67 pts. 9,440
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 65 pts. 9,438
  7. Avatar for Aubade01 17. Aubade01 Lv 1 63 pts. 9,436
  8. Avatar for O Seki To 18. O Seki To Lv 1 61 pts. 9,412
  9. Avatar for tokens 19. tokens Lv 1 59 pts. 9,403
  10. Avatar for gitwut 20. gitwut Lv 1 57 pts. 9,403

Comments