Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for bertro 21. bertro Lv 1 55 pts. 9,397
  2. Avatar for Deleted player 22. Deleted player pts. 9,385
  3. Avatar for randomlil 23. randomlil Lv 1 52 pts. 9,381
  4. Avatar for ZeroLeak7 24. ZeroLeak7 Lv 1 50 pts. 9,380
  5. Avatar for pmdpmd 25. pmdpmd Lv 1 49 pts. 9,377
  6. Avatar for Vredeman 26. Vredeman Lv 1 47 pts. 9,374
  7. Avatar for hpaege 27. hpaege Lv 1 46 pts. 9,373
  8. Avatar for kabubi 28. kabubi Lv 1 44 pts. 9,372
  9. Avatar for Museka 29. Museka Lv 1 43 pts. 9,350
  10. Avatar for Blipperman 30. Blipperman Lv 1 41 pts. 9,337

Comments